Skip to Content

Viewing BLAST Results

Viewing BLAST results saved to a persistent volume

The run of the stock BLAST workflow template saves results to a persistent volume. You can access and post-process these results from other Fuzzball workflows by mounting the same persistent volume in other Fuzzball workflows like, for example, Jupyter or an interactive shell. In the following example we will use the Fuzzball CLI to start a workflow that will sleep until it times out or we stop it and then connect to it to access the blast results

$ cat <<EOF > shell.fz version: v1 volumes: data: reference: volume://user/persistent jobs: shell: image: uri: docker://rockylinux:9 mounts: data: location: /data env: - "PS1=(fuzzball)$ " cwd: /data/results script: | #!/bin/sh sleep 8h resource: cpu: cores: 1 threads: true memory: size: 2GiB policy: timeout: execute: 8h EOF $ fuzzball workflow start shell.fz Workflow "ed24d154-4bd5-4695-b458-7f821710e4a7" started. $ fuzzball workflow describe ed24d154-4bd5-4695-b458-7f821710e4a7 Name: shell.fz Email: wresch@ciq.com UserId: 87145648-b830-4291-ab7e-40880d61334e Status: STAGE_STATUS_STARTED Cluster: fuzzball-aws-stable Created: 2025-04-23 01:45:59PM Started: 2025-04-23 01:45:59PM Finished: N/A Error: Stages: KIND | STATUS | NAME | STARTED | FINISHED Workflow | Started | ed24d154-4bd5-4695-b458-7f821710e4a7 | 2025-04-23 01:45:59PM | N/A Volume | Finished | data | 2025-04-23 01:46:00PM | 2025-04-23 01:46:32PM Image | Finished | docker://rockylinux:9 | 2025-04-23 01:46:00PM | 2025-04-23 01:46:21PM Job | Started | shell | 2025-04-23 01:48:48PM | N/A

The workflow is running and you can connect to it like so:

$ fuzzball workflow exec --tty ed24d154-4bd5-4695-b458-7f821710e4a7 shell /bin/bash (fuzzball)$ pwd /data/results (fuzzball)$ ls -lh blast total 40K drwxrwxr-x. 2 user group 6.0K Apr 18 17:35 301eb4c1-1f24-4cac-8d7d-8a6c67db16bb drwxrwxr-x. 2 user group 6.0K Apr 18 17:27 58abcdba-022f-4256-a516-2bb762a2b6b2 drwxrwxr-x. 2 user group 6.0K Apr 22 18:03 64888a33-ac09-4fb6-8db6-20aa35fbddc9 drwxrwxr-x. 2 user group 6.0K Apr 21 21:43 6bf078f5-575d-48a1-ae44-6c5532551f45 drwxrwxr-x. 2 user group 6.0K Apr 21 21:33 8c9625fa-802c-42dd-a065-2bf66a8a6680 drwxrwxr-x. 2 user group 6.0K Apr 18 19:44 cceab18b-dd1e-4553-bb05-a42bda1d76b3 drwxrwxr-x. 2 user group 6.0K Apr 18 20:54 d2b33c1c-8f0e-43fe-a052-bebc476c68d9 drwxrwxr-x. 2 user group 6.0K Apr 18 18:50 dad618e7-e965-4ee3-9ebc-f611ffe20924 drwxrwxr-x. 2 user group 6.0K Apr 18 13:49 e7b1e1d6-0d53-4aa1-a17f-b57a4603ee72 drwxrwxr-x. 2 user group 6.0K Apr 18 19:00 ed5e81ba-c354-43c5-9f23-b13d86596294 (fuzzball)$ head -30 blast/e7b1e1d6-0d53-4aa1-a17f-b57a4603ee72/pox_efc.blast.out BLASTP 2.16.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: PDB protein database 170,598 sequences; 48,617,182 total letters Query= YP_232915.1 serine protease inhibitor-like [Vaccinia virus] Length=369 Score E Sequences producing significant alignments: (Bits) Value 4KDS_A Chain A, Plasminogen activator inhibitor 1 [Oncorhynchus m... 153 3e-42 (fuzzball)$ exit $ fuzzball workflow stop ed24d154-4bd5-4695-b458-7f821710e4a7

Viewing BLAST results saved to S3

In a previous section, we created a modified workflow template that saved its BLAST result file {{.RunName}}.blast.out to an S3 bucket at destination s3://<bucket>/<path...>. In our example the saved object was s3://co-ciq-misc-support/results/pox_efc.blast.out which is what we will use below.

One method to download the results file to your workstation and view it is to use the AWS CLI to interface with the S3 bucket where your results are stored. If you do not have the AWS CLI installed, please see the AWS CLI installation instructions for more information.

Using the AWS CLI command aws s3 cp, the result file can be downloaded to your workstation. The command below copies the result file at S3 URI s3://<bucket>/<path...>/{{.RunName}}.blast.out to your working directory.

$ aws s3 cp s3://co-ciq-misc-support/results/pox_efc.blast.out .

From there you can use any standard tools to view, parse or process the BLAST output format you choose.

$ cat pox_efc.blast.out BLASTP 2.16.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: PDB protein database 170,598 sequences; 48,617,182 total letters Query= YP_233018.1 A16 Length=377 Score E Sequences producing significant alignments: (Bits) Value 8GP6_A Chain A, Virion membrane protein A16 [Vaccinia virus WR] 720 0.0 7AE2_B Chain B, MNT ANTITOXIN [Aphanizomenon flos-aquae 2012/KM1/D3] 30.8 2.7 3G02_A Chain A, Epoxide hydrolase [Aspergillus niger] 30.0 8.6 1QO7_A Chain A, EPOXIDE HYDROLASE [Aspergillus niger] 30.0 9.0 >8GP6_A Chain A, Virion membrane protein A16 [Vaccinia virus WR] Length=348 Score = 720 bits (1859), Expect = 0.0, Method: Compositional matrix adjust. Identities = 342/342 (100%), Positives = 342/342 (100%), Gaps = 0/342 (0%) Query 1 MGAAVTLNRIKIAPGIADIRDKYMELGFNYPEYNRAVKFAEESYTYYYETSPGEIKPKFC 60 MGAAVTLNRIKIAPGIADIRDKYMELGFNYPEYNRAVKFAEESYTYYYETSPGEIKPKFC Sbjct 1 MGAAVTLNRIKIAPGIADIRDKYMELGFNYPEYNRAVKFAEESYTYYYETSPGEIKPKFC 60 ...snip...